PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00722.40
Common NameJCGZ_25526, LOC105646504
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 394aa    MW: 44822.1 Da    PI: 6.5117
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00722.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.31.7e-28216266151
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                    k+r+rWt++LHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQ
  Jcr4S00722.40 216 KTRIRWTQDLHEKFVECVNRLGGAEKATPKAILKLMDTDGLTIFHVKSHLQ 266
                    68************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.995213273IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-24214266IPR009057Homeodomain-like
SuperFamilySSF466892.51E-14214267IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-21216268IPR006447Myb domain, plants
PfamPF002493.1E-7220267IPR001005SANT/Myb domain
PfamPF143792.3E-20305350IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MNTSKIDFQE RVQQNHGVIS DFALNSLQCF DSQQNWKMGV PILTQVMEEE QQQHQDFRHD  60
KSSTSIMSRF ESPASAFYAT EKYMGFPLYD CQVGAYSKSY DSQFTSQNSL VQNYPISSME  120
QRSDHSLESR NSLLSIYKGP CSTGNKLHQL ERNKLLNNGA AIHLSIPFHG DQDYRIGCNP  180
CSSPFGQMGF PLQREIQSSR LTSRNPVATG AVLSSKTRIR WTQDLHEKFV ECVNRLGGAE  240
KATPKAILKL MDTDGLTIFH VKSHLQVILN IELQSNLPDP SEGKAEKRTS INEVPQIDAR  300
TSGLQITEAL QLQLDVQRRL HEQLEIQKNL QLRIEEQGRQ LQRMFDQQQR KNQTLFNTQN  360
SDPNSPDESE FSLDDFEVSI AEGSNSTHFK SKIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087751.10.0PREDICTED: uncharacterized protein LOC105646504
TrEMBLA0A067JX820.0A0A067JX82_JATCU; Uncharacterized protein
STRINGPOPTR_0006s20540.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-62G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]